Alzheimer’s disease (AD) symptomatology, while classically studied through the lens of amyloid-β and tau burden, is likely also influenced by multiple-interacting co-pathologies like vascular disease
aMPER peptide: EQELLELDKWASLWNWFDITKWLWYIKKKKGSKKK.bLinked peptide: EQELLELDKWASLGGGGSGGWNWFDITKWLWYIKKKKGSKKK.cES2 scaffold: scaffold protein displaying the 2F5 gp41 epitope stabilized in the antibod
Crystal structure of the NK1 domain of HGF in complex with anti-HGF monoclonal antibody SFN68. Descriptor: HEPATOCYTE GROWTH FACTOR, SFN68 FAB Authors: Kang, Y.J, Kim, K.L, Cho, H.S, Chung, J.H. Depos
